POLM,Tdt-N
  • POLM,Tdt-N

Anti-POLM Antibody 100ul

Ref: AN-HPA066007-100ul
Anti-POLM

Información del producto

Polyclonal Antibody against Human POLM, Gene description: polymerase (DNA directed), mu, Alternative Gene Names: Tdt-N, Validated applications: ICC, WB, Uniprot ID: Q9NP87, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POLM
Gene Description polymerase (DNA directed), mu
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
Immunogen SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Tdt-N
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NP87
HTS Code 3002150000
Gene ID 27434
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POLM Antibody 100ul

Anti-POLM Antibody 100ul