MKRN2OS,C3orf83
  • MKRN2OS,C3orf83

Anti-MKRN2OS Antibody 100ul

Ref: AN-HPA065753-100ul
Anti-MKRN2OS

Información del producto

Polyclonal Antibody against Human MKRN2OS, Gene description: MKRN2 opposite strand, Alternative Gene Names: C3orf83, MKRN2-AS1, Validated applications: ICC, IHC, Uniprot ID: H3BPM6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MKRN2OS
Gene Description MKRN2 opposite strand
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence YDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNH
Immunogen YDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C3orf83, MKRN2-AS1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID H3BPM6
HTS Code 3002150000
Gene ID 100129480
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MKRN2OS Antibody 100ul

Anti-MKRN2OS Antibody 100ul