AP5B1,AP-5
  • AP5B1,AP-5

Anti-AP5B1 Antibody 25ul

Ref: AN-HPA065739-25ul
Anti-AP5B1

Información del producto

Polyclonal Antibody against Human AP5B1, Gene description: adaptor-related protein complex 5, beta 1 subunit, Alternative Gene Names: AP-5, DKFZp761E198, PP1030, Validated applications: ICC, IHC, Uniprot ID: Q2VPB7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AP5B1
Gene Description adaptor-related protein complex 5, beta 1 subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence HALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHL
Immunogen HALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-5, DKFZp761E198, PP1030
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q2VPB7
HTS Code 3002150000
Gene ID 91056
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AP5B1 Antibody 25ul

Anti-AP5B1 Antibody 25ul