VPS72,Swc2,TCFL1
  • VPS72,Swc2,TCFL1

Anti-VPS72 Antibody 25ul

Ref: AN-HPA065709-25ul
Anti-VPS72

Información del producto

Polyclonal Antibody against Human VPS72, Gene description: vacuolar protein sorting 72 homolog (S. cerevisiae), Alternative Gene Names: Swc2, TCFL1, YL-1, YL1, Validated applications: ICC, Uniprot ID: Q15906, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VPS72
Gene Description vacuolar protein sorting 72 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
Immunogen RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Swc2, TCFL1, YL-1, YL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15906
HTS Code 3002150000
Gene ID 6944
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VPS72 Antibody 25ul

Anti-VPS72 Antibody 25ul