WBP2,WBP-2
  • WBP2,WBP-2

Anti-WBP2 Antibody 25ul

Ref: AN-HPA065682-25ul
Anti-WBP2

Información del producto

Polyclonal Antibody against Human WBP2, Gene description: WW domain binding protein 2, Alternative Gene Names: WBP-2, Validated applications: IHC, Uniprot ID: Q969T9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WBP2
Gene Description WW domain binding protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFG
Immunogen VNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names WBP-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969T9
HTS Code 3002150000
Gene ID 23558
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WBP2 Antibody 25ul

Anti-WBP2 Antibody 25ul