C20orf85,bA196N14.1
  • C20orf85,bA196N14.1

Anti-C20orf85 Antibody 25ul

Ref: AN-HPA065540-25ul
Anti-C20orf85

Información del producto

Polyclonal Antibody against Human C20orf85, Gene description: chromosome 20 open reading frame 85, Alternative Gene Names: bA196N14.1, LLC1, Validated applications: IHC, Uniprot ID: Q9H1P6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C20orf85
Gene Description chromosome 20 open reading frame 85
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH
Immunogen FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA196N14.1, LLC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1P6
HTS Code 3002150000
Gene ID 128602
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C20orf85 Antibody 25ul

Anti-C20orf85 Antibody 25ul