MEX3D,KIAA2031
  • MEX3D,KIAA2031

Anti-MEX3D Antibody 100ul

Ref: AN-HPA065385-100ul
Anti-MEX3D

Información del producto

Polyclonal Antibody against Human MEX3D, Gene description: mex-3 RNA binding family member D, Alternative Gene Names: KIAA2031, OK/SW-cl.4, RKHD1, RNF193, Tino, Validated applications: IHC, Uniprot ID: Q86XN8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MEX3D
Gene Description mex-3 RNA binding family member D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DVFAGFAPHPAALGPPTLLADQMSVICGRKK
Immunogen DVFAGFAPHPAALGPPTLLADQMSVICGRKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA2031, OK/SW-cl.4, RKHD1, RNF193, Tino
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86XN8
HTS Code 3002150000
Gene ID 399664
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MEX3D Antibody 100ul

Anti-MEX3D Antibody 100ul