KRBOX4,FLJ20344
  • KRBOX4,FLJ20344

Anti-KRBOX4 Antibody 25ul

Ref: AN-HPA065295-25ul
Anti-KRBOX4

Información del producto

Polyclonal Antibody against Human KRBOX4, Gene description: KRAB box domain containing 4, Alternative Gene Names: FLJ20344, ZNF673, Validated applications: ICC, Uniprot ID: Q5JUW0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KRBOX4
Gene Description KRAB box domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VDEQIDHYKESQDKLPWQAAFIGKETLKDESGQ
Immunogen VDEQIDHYKESQDKLPWQAAFIGKETLKDESGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20344, ZNF673
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5JUW0
HTS Code 3002150000
Gene ID 55634
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KRBOX4 Antibody 25ul

Anti-KRBOX4 Antibody 25ul