ZDHHC21,DNZ1,HSPC097
  • ZDHHC21,DNZ1,HSPC097

Anti-ZDHHC21 Antibody 25ul

Ref: AN-HPA065254-25ul
Anti-ZDHHC21

Información del producto

Polyclonal Antibody against Human ZDHHC21, Gene description: zinc finger, DHHC-type containing 21, Alternative Gene Names: DNZ1, HSPC097, Validated applications: ICC, IHC, Uniprot ID: Q8IVQ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZDHHC21
Gene Description zinc finger, DHHC-type containing 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
Immunogen RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DNZ1, HSPC097
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IVQ6
HTS Code 3002150000
Gene ID 340481
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZDHHC21 Antibody 25ul

Anti-ZDHHC21 Antibody 25ul