ZDHHC21,DNZ1,HSPC097 View larger

Anti-ZDHHC21 Antibody 25ul

AN-HPA065254-25ul

New product

Anti-ZDHHC21

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25ul
Gene Name ZDHHC21
Gene Description zinc finger, DHHC-type containing 21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
Immunogen RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DNZ1, HSPC097
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IVQ6
HTS Code 3002150000
Gene ID 340481
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC, IHC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human ZDHHC21, Gene description: zinc finger, DHHC-type containing 21, Alternative Gene Names: DNZ1, HSPC097, Validated applications: ICC, IHC, Uniprot ID: Q8IVQ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image