C1QTNF3
  • C1QTNF3

Anti-C1QTNF3 Antibody 25ul

Ref: AN-HPA064996-25ul
Anti-C1QTNF3

Información del producto

Polyclonal Antibody against Human C1QTNF3, Gene description: C1q and tumor necrosis factor related protein 3, Alternative Gene Names: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3, Validated applications: IHC, Uniprot ID: Q9BXJ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C1QTNF3
Gene Description C1q and tumor necrosis factor related protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET
Immunogen MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXJ4
HTS Code 3002150000
Gene ID 114899
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C1QTNF3 Antibody 25ul

Anti-C1QTNF3 Antibody 25ul