EIF2S1,EIF-2alpha
  • EIF2S1,EIF-2alpha

Anti-EIF2S1 Antibody 25ul

Ref: AN-HPA064885-25ul
Anti-EIF2S1

Información del producto

Polyclonal Antibody against Human EIF2S1, Gene description: eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa, Alternative Gene Names: EIF-2alpha, EIF2, EIF2A, Validated applications: ICC, IHC, WB, Uniprot ID: P05198, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF2S1
Gene Description eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG
Immunogen IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EIF-2alpha, EIF2, EIF2A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P05198
HTS Code 3002150000
Gene ID 1965
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF2S1 Antibody 25ul

Anti-EIF2S1 Antibody 25ul