TBKBP1,KIAA0775
  • TBKBP1,KIAA0775

Anti-TBKBP1 Antibody 100ul

Ref: AN-HPA064856-100ul
Anti-TBKBP1

Información del producto

Polyclonal Antibody against Human TBKBP1, Gene description: TBK1 binding protein 1, Alternative Gene Names: KIAA0775, ProSAPiP2, Validated applications: IHC, WB, Uniprot ID: A7MCY6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TBKBP1
Gene Description TBK1 binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSG
Immunogen ELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0775, ProSAPiP2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A7MCY6
HTS Code 3002150000
Gene ID 9755
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TBKBP1 Antibody 100ul

Anti-TBKBP1 Antibody 100ul