ZBTB4,KAISO-L1
  • ZBTB4,KAISO-L1

Anti-ZBTB4 Antibody 25ul

Ref: AN-HPA064763-25ul
Anti-ZBTB4

Información del producto

Polyclonal Antibody against Human ZBTB4, Gene description: zinc finger and BTB domain containing 4, Alternative Gene Names: KAISO-L1, KIAA1538, ZNF903, Validated applications: ICC, IHC, Uniprot ID: Q9P1Z0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB4
Gene Description zinc finger and BTB domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV
Immunogen TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KAISO-L1, KIAA1538, ZNF903
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P1Z0
HTS Code 3002150000
Gene ID 57659
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZBTB4 Antibody 25ul

Anti-ZBTB4 Antibody 25ul