FAM83F
  • FAM83F

Anti-FAM83F Antibody 25ul

Ref: AN-HPA064657-25ul
Anti-FAM83F

Información del producto

Polyclonal Antibody against Human FAM83F, Gene description: family with sequence similarity 83, member F, Validated applications: ICC, Uniprot ID: Q8NEG4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM83F
Gene Description family with sequence similarity 83, member F
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SYRFTWSSSHVDRNLLLLLTGQNVEPFDTEFRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLIN
Immunogen SYRFTWSSSHVDRNLLLLLTGQNVEPFDTEFRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLIN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NEG4
HTS Code 3002150000
Gene ID 113828
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM83F Antibody 25ul

Anti-FAM83F Antibody 25ul