KMT5A,PR-Set7,SET07
  • KMT5A,PR-Set7,SET07

Anti-KMT5A Antibody 25ul

Ref: AN-HPA064495-25ul
Anti-KMT5A

Información del producto

Polyclonal Antibody against Human KMT5A, Gene description: lysine methyltransferase 5A, Alternative Gene Names: PR-Set7, SET07, SET8, SETD8, Validated applications: ICC, Uniprot ID: Q9NQR1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KMT5A
Gene Description lysine methyltransferase 5A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK
Immunogen KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PR-Set7, SET07, SET8, SETD8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQR1
HTS Code 3002150000
Gene ID 387893
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KMT5A Antibody 25ul

Anti-KMT5A Antibody 25ul