TSTD2,C9orf97,PP4189
  • TSTD2,C9orf97,PP4189

Anti-TSTD2 Antibody 100ul

Ref: AN-HPA064304-100ul
Anti-TSTD2

Información del producto

Polyclonal Antibody against Human TSTD2, Gene description: thiosulfate sulfurtransferase (rhodanese)-like domain containing 2, Alternative Gene Names: C9orf97, PP4189, Validated applications: ICC, Uniprot ID: Q5T7W7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSTD2
Gene Description thiosulfate sulfurtransferase (rhodanese)-like domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EFPDGFYKGKLFVFDERYALSYNSDVVSECSYCGARWDQYKLCSTPQCRQLVLTCPACQGQGFTACCVTCQDKGSRKVSGPMQDSFKEECECTARRPRIPRELLQHV
Immunogen EFPDGFYKGKLFVFDERYALSYNSDVVSECSYCGARWDQYKLCSTPQCRQLVLTCPACQGQGFTACCVTCQDKGSRKVSGPMQDSFKEECECTARRPRIPRELLQHV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf97, PP4189
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T7W7
HTS Code 3002150000
Gene ID 158427
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSTD2 Antibody 100ul

Anti-TSTD2 Antibody 100ul