EID2B,EID-3,FLJ38944
  • EID2B,EID-3,FLJ38944

Anti-EID2B Antibody 25ul

Ref: AN-HPA064185-25ul
Anti-EID2B

Información del producto

Polyclonal Antibody against Human EID2B, Gene description: EP300 interacting inhibitor of differentiation 2B, Alternative Gene Names: EID-3, FLJ38944, Validated applications: IHC, Uniprot ID: Q96D98, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EID2B
Gene Description EP300 interacting inhibitor of differentiation 2B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
Immunogen QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EID-3, FLJ38944
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96D98
HTS Code 3002150000
Gene ID 126272
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EID2B Antibody 25ul

Anti-EID2B Antibody 25ul