MED14,CRSP150,CRSP2
  • MED14,CRSP150,CRSP2

Anti-MED14 Antibody 100ul

Ref: AN-HPA064182-100ul
Anti-MED14

Información del producto

Polyclonal Antibody against Human MED14, Gene description: mediator complex subunit 14, Alternative Gene Names: CRSP150, CRSP2, CSRP, CXorf4, EXLM1, RGR1, TRAP170, Validated applications: ICC, Uniprot ID: O60244, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MED14
Gene Description mediator complex subunit 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Immunogen PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRSP150, CRSP2, CSRP, CXorf4, EXLM1, RGR1, TRAP170
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60244
HTS Code 3002150000
Gene ID 9282
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MED14 Antibody 100ul

Anti-MED14 Antibody 100ul