ZNF335,bA465L10.2
  • ZNF335,bA465L10.2

Anti-ZNF335 Antibody 25ul

Ref: AN-HPA063999-25ul
Anti-ZNF335

Información del producto

Polyclonal Antibody against Human ZNF335, Gene description: zinc finger protein 335, Alternative Gene Names: bA465L10.2, NIF-1, Validated applications: ICC, Uniprot ID: Q9H4Z2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF335
Gene Description zinc finger protein 335
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RNGHLKFHIQRLHSPDGRKSGTPTARAPTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQ
Immunogen RNGHLKFHIQRLHSPDGRKSGTPTARAPTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA465L10.2, NIF-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4Z2
HTS Code 3002150000
Gene ID 63925
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF335 Antibody 25ul

Anti-ZNF335 Antibody 25ul