RPL36A,L36A,RPL44
  • RPL36A,L36A,RPL44

Anti-RPL36A Antibody 25ul

Ref: AN-HPA063979-25ul
Anti-RPL36A

Información del producto

Polyclonal Antibody against Human RPL36A, Gene description: ribosomal protein L36a, Alternative Gene Names: L36A, RPL44, Validated applications: IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPL36A
Gene Description ribosomal protein L36a
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MIAPTDSHEEVRSGTSYILPFASRFLSFRA
Immunogen MIAPTDSHEEVRSGTSYILPFASRFLSFRA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L36A, RPL44
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 6173
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPL36A Antibody 25ul

Anti-RPL36A Antibody 25ul