DCD,AIDD,DCD-1,DSEP
  • DCD,AIDD,DCD-1,DSEP

Anti-DCD Antibody 100ul

Ref: AN-HPA063967-100ul
Anti-DCD

Información del producto

Polyclonal Antibody against Human DCD, Gene description: dermcidin, Alternative Gene Names: AIDD, DCD-1, DSEP, HCAP, PIF, Validated applications: IHC, Uniprot ID: P81605, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCD
Gene Description dermcidin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Immunogen AYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AIDD, DCD-1, DSEP, HCAP, PIF
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P81605
HTS Code 3002150000
Gene ID 117159
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DCD Antibody 100ul

Anti-DCD Antibody 100ul