C11orf71,FLJ20010
  • C11orf71,FLJ20010

Anti-C11orf71 Antibody 100ul

Ref: AN-HPA063943-100ul
Anti-C11orf71

Información del producto

Polyclonal Antibody against Human C11orf71, Gene description: chromosome 11 open reading frame 71, Alternative Gene Names: FLJ20010, Validated applications: ICC, Uniprot ID: Q6IPW1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C11orf71
Gene Description chromosome 11 open reading frame 71
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MALNNVSLSSGDQRSRVAYRSSHGDLRPRASALAMVSGDGF
Immunogen MALNNVSLSSGDQRSRVAYRSSHGDLRPRASALAMVSGDGF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20010
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IPW1
HTS Code 3002150000
Gene ID 54494
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C11orf71 Antibody 100ul

Anti-C11orf71 Antibody 100ul