APBB1IP,INAG1,RIAM
  • APBB1IP,INAG1,RIAM

Anti-APBB1IP Antibody 100ul

Ref: AN-HPA063903-100ul
Anti-APBB1IP

Información del producto

Polyclonal Antibody against Human APBB1IP, Gene description: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein, Alternative Gene Names: INAG1, RIAM, Validated applications: ICC, IHC, Uniprot ID: Q7Z5R6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name APBB1IP
Gene Description amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Immunogen KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names INAG1, RIAM
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z5R6
HTS Code 3002150000
Gene ID 54518
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-APBB1IP Antibody 100ul

Anti-APBB1IP Antibody 100ul