C5orf51,LOC285636
  • C5orf51,LOC285636

Anti-C5orf51 Antibody 100ul

Ref: AN-HPA063816-100ul
Anti-C5orf51

Información del producto

Polyclonal Antibody against Human C5orf51, Gene description: chromosome 5 open reading frame 51, Alternative Gene Names: LOC285636, Validated applications: ICC, Uniprot ID: A6NDU8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C5orf51
Gene Description chromosome 5 open reading frame 51
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPED
Immunogen VRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LOC285636
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NDU8
HTS Code 3002150000
Gene ID 285636
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C5orf51 Antibody 100ul

Anti-C5orf51 Antibody 100ul