RGCC,bA157L14.2
  • RGCC,bA157L14.2

Anti-RGCC Antibody 25ul

Ref: AN-HPA063701-25ul
Anti-RGCC

Información del producto

Polyclonal Antibody against Human RGCC, Gene description: regulator of cell cycle, Alternative Gene Names: bA157L14.2, C13orf15, RGC-32, RGC32, Validated applications: ICC, Uniprot ID: Q9H4X1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RGCC
Gene Description regulator of cell cycle
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LSDALCEFDAVLADFASPFHERHFHYEEHLERMK
Immunogen LSDALCEFDAVLADFASPFHERHFHYEEHLERMK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA157L14.2, C13orf15, RGC-32, RGC32
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4X1
HTS Code 3002150000
Gene ID 28984
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RGCC Antibody 25ul

Anti-RGCC Antibody 25ul