KMT5B,CGI-85
  • KMT5B,CGI-85

Anti-KMT5B Antibody 25ul

Ref: AN-HPA063648-25ul
Anti-KMT5B

Información del producto

Polyclonal Antibody against Human KMT5B, Gene description: lysine methyltransferase 5B, Alternative Gene Names: CGI-85, SUV420H1, Validated applications: ICC, Uniprot ID: Q4FZB7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KMT5B
Gene Description lysine methyltransferase 5B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
Immunogen DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-85, SUV420H1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4FZB7
HTS Code 3002150000
Gene ID 51111
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KMT5B Antibody 25ul

Anti-KMT5B Antibody 25ul