CAPRIN1,caprin-1
  • CAPRIN1,caprin-1

Anti-CAPRIN1 Antibody 25ul

Ref: AN-HPA063617-25ul
Anti-CAPRIN1

Información del producto

Polyclonal Antibody against Human CAPRIN1, Gene description: cell cycle associated protein 1, Alternative Gene Names: caprin-1, GPIAP1, M11S1, RNG105, Validated applications: IHC, WB, Uniprot ID: Q14444, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CAPRIN1
Gene Description cell cycle associated protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM
Immunogen TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names caprin-1, GPIAP1, M11S1, RNG105
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14444
HTS Code 3002150000
Gene ID 4076
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CAPRIN1 Antibody 25ul

Anti-CAPRIN1 Antibody 25ul