LIX1L,MGC46719
  • LIX1L,MGC46719

Anti-LIX1L Antibody 25ul

Ref: AN-HPA063598-25ul
Anti-LIX1L

Información del producto

Polyclonal Antibody against Human LIX1L, Gene description: limb and CNS expressed 1 like, Alternative Gene Names: MGC46719, Validated applications: ICC, Uniprot ID: Q8IVB5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LIX1L
Gene Description limb and CNS expressed 1 like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYV
Immunogen PAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC46719
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IVB5
HTS Code 3002150000
Gene ID 128077
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LIX1L Antibody 25ul

Anti-LIX1L Antibody 25ul