OSR2,FLJ90037
  • OSR2,FLJ90037

Anti-OSR2 Antibody 100ul

Ref: AN-HPA063486-100ul
Anti-OSR2

Información del producto

Polyclonal Antibody against Human OSR2, Gene description: odd-skipped related transciption factor 2, Alternative Gene Names: FLJ90037, Validated applications: ICC, WB, Uniprot ID: Q8N2R0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OSR2
Gene Description odd-skipped related transciption factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence THRSQELRGAAATEGFLYVLLSHWVFVGAPRPPASDSWKKGLVPSAPPASRKMGSKALPAPIPLHPSLQL
Immunogen THRSQELRGAAATEGFLYVLLSHWVFVGAPRPPASDSWKKGLVPSAPPASRKMGSKALPAPIPLHPSLQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90037
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N2R0
HTS Code 3002150000
Gene ID 116039
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OSR2 Antibody 100ul

Anti-OSR2 Antibody 100ul