ZNF12,GIOT-3,KOX3
  • ZNF12,GIOT-3,KOX3

Anti-ZNF12 Antibody 100ul

Ref: AN-HPA063402-100ul
Anti-ZNF12

Información del producto

Polyclonal Antibody against Human ZNF12, Gene description: zinc finger protein 12, Alternative Gene Names: GIOT-3, KOX3, ZNF325, Validated applications: ICC, Uniprot ID: P17014, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF12
Gene Description zinc finger protein 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPY
Immunogen EYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GIOT-3, KOX3, ZNF325
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17014
HTS Code 3002150000
Gene ID 7559
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF12 Antibody 100ul

Anti-ZNF12 Antibody 100ul