TRAPPC2,hYP38334
  • TRAPPC2,hYP38334

Anti-TRAPPC2 Antibody 100ul

Ref: AN-HPA063308-100ul
Anti-TRAPPC2

Información del producto

Polyclonal Antibody against Human TRAPPC2, Gene description: trafficking protein particle complex 2, Alternative Gene Names: hYP38334, MIP-2A, SEDL, SEDT, TRS20, ZNF547L, Validated applications: ICC, Uniprot ID: P0DI81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TRAPPC2
Gene Description trafficking protein particle complex 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAF
Immunogen SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hYP38334, MIP-2A, SEDL, SEDT, TRS20, ZNF547L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0DI81
HTS Code 3002150000
Gene ID 6399
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRAPPC2 Antibody 100ul

Anti-TRAPPC2 Antibody 100ul