ETS1,ETS-1,EWSR2
  • ETS1,ETS-1,EWSR2

Anti-ETS1 Antibody 25ul

Ref: AN-HPA063230-25ul
Anti-ETS1

Información del producto

Polyclonal Antibody against Human ETS1, Gene description: v-ets avian erythroblastosis virus E26 oncogene homolog 1, Alternative Gene Names: ETS-1, EWSR2, FLJ10768, Validated applications: ICC, WB, Uniprot ID: P14921, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ETS1
Gene Description v-ets avian erythroblastosis virus E26 oncogene homolog 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Immunogen VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ETS-1, EWSR2, FLJ10768
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P14921
HTS Code 3002150000
Gene ID 2113
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ETS1 Antibody 25ul

Anti-ETS1 Antibody 25ul