TM4SF20,FLJ22800
  • TM4SF20,FLJ22800

Anti-TM4SF20 Antibody 25ul

Ref: AN-HPA063184-25ul
Anti-TM4SF20

Información del producto

Polyclonal Antibody against Human TM4SF20, Gene description: transmembrane 4 L six family member 20, Alternative Gene Names: FLJ22800, TCCE518, Validated applications: IHC, Uniprot ID: Q53R12, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TM4SF20
Gene Description transmembrane 4 L six family member 20
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QALLKGPLMCNSPSNSNANCEFSLKNISDI
Immunogen QALLKGPLMCNSPSNSNANCEFSLKNISDI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22800, TCCE518
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53R12
HTS Code 3002150000
Gene ID 79853
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TM4SF20 Antibody 25ul

Anti-TM4SF20 Antibody 25ul