IRF1,MAR
  • IRF1,MAR

Anti-IRF1 Antibody 100ul

Ref: AN-HPA063131-100ul
Anti-IRF1

Información del producto

Polyclonal Antibody against Human IRF1, Gene description: interferon regulatory factor 1, Alternative Gene Names: MAR, Validated applications: IHC, Uniprot ID: P10914, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IRF1
Gene Description interferon regulatory factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTP
Immunogen SAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MAR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P10914
HTS Code 3002150000
Gene ID 3659
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IRF1 Antibody 100ul

Anti-IRF1 Antibody 100ul