CHML,REP-2
  • CHML,REP-2

Anti-CHML Antibody 25ul

Ref: AN-HPA062967-25ul
Anti-CHML

Información del producto

Polyclonal Antibody against Human CHML, Gene description: choroideremia-like (Rab escort protein 2), Alternative Gene Names: REP-2, Validated applications: ICC, Uniprot ID: P26374, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHML
Gene Description choroideremia-like (Rab escort protein 2)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY
Immunogen LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names REP-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P26374
HTS Code 3002150000
Gene ID 1122
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CHML Antibody 25ul

Anti-CHML Antibody 25ul