DYNC2LI1,CGI-60
  • DYNC2LI1,CGI-60

Anti-DYNC2LI1 Antibody 100ul

Ref: AN-HPA062905-100ul
Anti-DYNC2LI1

Información del producto

Polyclonal Antibody against Human DYNC2LI1, Gene description: dynein, cytoplasmic 2, light intermediate chain 1, Alternative Gene Names: CGI-60, D2LIC, DKFZP564A033, LIC3, Validated applications: ICC, IHC, WB, Uniprot ID: Q8TCX1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DYNC2LI1
Gene Description dynein, cytoplasmic 2, light intermediate chain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL
Immunogen PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-60, D2LIC, DKFZP564A033, LIC3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TCX1
HTS Code 3002150000
Gene ID 51626
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DYNC2LI1 Antibody 100ul

Anti-DYNC2LI1 Antibody 100ul