CFAP69,C7orf63
  • CFAP69,C7orf63

Anti-CFAP69 Antibody 100ul

Ref: AN-HPA062883-100ul
Anti-CFAP69

Información del producto

Polyclonal Antibody against Human CFAP69, Gene description: cilia and flagella associated protein 69, Alternative Gene Names: C7orf63, FAP69, FLJ21062, Validated applications: IHC, Uniprot ID: A5D8W1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CFAP69
Gene Description cilia and flagella associated protein 69
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA
Immunogen MDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C7orf63, FAP69, FLJ21062
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A5D8W1
HTS Code 3002150000
Gene ID 79846
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CFAP69 Antibody 100ul

Anti-CFAP69 Antibody 100ul