NKX2-8,Nkx2-9
  • NKX2-8,Nkx2-9

Anti-NKX2-8 Antibody 100ul

Ref: AN-HPA062879-100ul
Anti-NKX2-8

Información del producto

Polyclonal Antibody against Human NKX2-8, Gene description: NK2 homeobox 8, Alternative Gene Names: Nkx2-9, NKX2.8, NKX2H, Validated applications: ICC, IHC, Uniprot ID: O15522, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NKX2-8
Gene Description NK2 homeobox 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR
Immunogen TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Nkx2-9, NKX2.8, NKX2H
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15522
HTS Code 3002150000
Gene ID 26257
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NKX2-8 Antibody 100ul

Anti-NKX2-8 Antibody 100ul