SPSB4,SSB-4
  • SPSB4,SSB-4

Anti-SPSB4 Antibody 25ul

Ref: AN-HPA062793-25ul
Anti-SPSB4

Información del producto

Polyclonal Antibody against Human SPSB4, Gene description: splA/ryanodine receptor domain and SOCS box containing 4, Alternative Gene Names: SSB-4, Validated applications: ICC, Uniprot ID: Q96A44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPSB4
Gene Description splA/ryanodine receptor domain and SOCS box containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH
Immunogen QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SSB-4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96A44
HTS Code 3002150000
Gene ID 92369
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPSB4 Antibody 25ul

Anti-SPSB4 Antibody 25ul