DOK7,C4orf25,Dok-7
  • DOK7,C4orf25,Dok-7

Anti-DOK7 Antibody 100ul

Ref: AN-HPA062780-100ul
Anti-DOK7

Información del producto

Polyclonal Antibody against Human DOK7, Gene description: docking protein 7, Alternative Gene Names: C4orf25, Dok-7, FLJ33718, FLJ39137, Validated applications: ICC, WB, Uniprot ID: Q18PE1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DOK7
Gene Description docking protein 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence TLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQE
Immunogen TLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf25, Dok-7, FLJ33718, FLJ39137
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q18PE1
HTS Code 3002150000
Gene ID 285489
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DOK7 Antibody 100ul

Anti-DOK7 Antibody 100ul