RSL24D1,C15orf15
  • RSL24D1,C15orf15

Anti-RSL24D1 Antibody 100ul

Ref: AN-HPA062724-100ul
Anti-RSL24D1

Información del producto

Polyclonal Antibody against Human RSL24D1, Gene description: ribosomal L24 domain containing 1, Alternative Gene Names: C15orf15, HRP-L30-iso, L30, RPL24, RPL24L, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UHA3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RSL24D1
Gene Description ribosomal L24 domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Immunogen QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UHA3
HTS Code 3002150000
Gene ID 51187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RSL24D1 Antibody 100ul

Anti-RSL24D1 Antibody 100ul