GIPC2,FLJ20075
  • GIPC2,FLJ20075

Anti-GIPC2 Antibody 25ul

Ref: AN-HPA062684-25ul
Anti-GIPC2

Información del producto

Polyclonal Antibody against Human GIPC2, Gene description: GIPC PDZ domain containing family, member 2, Alternative Gene Names: FLJ20075, SEMCAP-2, Validated applications: IHC, Uniprot ID: Q8TF65, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GIPC2
Gene Description GIPC PDZ domain containing family, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMER
Immunogen SATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20075, SEMCAP-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TF65
HTS Code 3002150000
Gene ID 54810
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GIPC2 Antibody 25ul

Anti-GIPC2 Antibody 25ul