LRRTM1,FLJ32082
  • LRRTM1,FLJ32082

Anti-LRRTM1 Antibody 100ul

Ref: AN-HPA062660-100ul
Anti-LRRTM1

Información del producto

Polyclonal Antibody against Human LRRTM1, Gene description: leucine rich repeat transmembrane neuronal 1, Alternative Gene Names: FLJ32082, Validated applications: IHC, Uniprot ID: Q86UE6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LRRTM1
Gene Description leucine rich repeat transmembrane neuronal 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLD
Immunogen HFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ32082
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UE6
HTS Code 3002150000
Gene ID 347730
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LRRTM1 Antibody 100ul

Anti-LRRTM1 Antibody 100ul