WNT10B,SHFM6,WNT-12
  • WNT10B,SHFM6,WNT-12

Anti-WNT10B Antibody 100ul

Ref: AN-HPA062539-100ul
Anti-WNT10B

Información del producto

Polyclonal Antibody against Human WNT10B, Gene description: wingless-type MMTV integration site family, member 10B, Alternative Gene Names: SHFM6, WNT-12, Validated applications: ICC, Uniprot ID: O00744, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WNT10B
Gene Description wingless-type MMTV integration site family, member 10B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS
Immunogen SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SHFM6, WNT-12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00744
HTS Code 3002150000
Gene ID 7480
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WNT10B Antibody 100ul

Anti-WNT10B Antibody 100ul