SDPR,cavin-2,CAVIN2
  • SDPR,cavin-2,CAVIN2

Anti-SDPR Antibody 25ul

Ref: AN-HPA062122-25ul
Anti-SDPR

Información del producto

Polyclonal Antibody against Human SDPR, Gene description: serum deprivation response, Alternative Gene Names: cavin-2, CAVIN2, PS-p68, SDR, Validated applications: ICC, Uniprot ID: O95810, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SDPR
Gene Description serum deprivation response
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLT
Immunogen QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cavin-2, CAVIN2, PS-p68, SDR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95810
HTS Code 3002150000
Gene ID 8436
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SDPR Antibody 25ul

Anti-SDPR Antibody 25ul