CSF2,GM-CSF,GMCSF
  • CSF2,GM-CSF,GMCSF

Anti-CSF2 Antibody 100ul

Ref: AN-HPA062006-100ul
Anti-CSF2

Información del producto

Polyclonal Antibody against Human CSF2, Gene description: colony stimulating factor 2 (granulocyte-macrophage), Alternative Gene Names: GM-CSF, GMCSF, Validated applications: ICC, Uniprot ID: P04141, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CSF2
Gene Description colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
Immunogen PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GM-CSF, GMCSF
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P04141
HTS Code 3002150000
Gene ID 1437
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CSF2 Antibody 100ul

Anti-CSF2 Antibody 100ul