SORCS2,KIAA1329
  • SORCS2,KIAA1329

Anti-SORCS2 Antibody 100ul

Ref: AN-HPA061916-100ul
Anti-SORCS2

Información del producto

Polyclonal Antibody against Human SORCS2, Gene description: sortilin-related VPS10 domain containing receptor 2, Alternative Gene Names: KIAA1329, Validated applications: ICC, Uniprot ID: Q96PQ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SORCS2
Gene Description sortilin-related VPS10 domain containing receptor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYG
Immunogen DWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1329
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PQ0
HTS Code 3002150000
Gene ID 57537
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SORCS2 Antibody 100ul

Anti-SORCS2 Antibody 100ul