BBS12,C4orf24
  • BBS12,C4orf24

Anti-BBS12 Antibody 25ul

Ref: AN-HPA061856-25ul
Anti-BBS12

Información del producto

Polyclonal Antibody against Human BBS12, Gene description: Bardet-Biedl syndrome 12, Alternative Gene Names: C4orf24, FLJ35630, FLJ41559, Validated applications: IHC, Uniprot ID: Q6ZW61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BBS12
Gene Description Bardet-Biedl syndrome 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL
Immunogen EFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf24, FLJ35630, FLJ41559
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZW61
HTS Code 3002150000
Gene ID 166379
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BBS12 Antibody 25ul

Anti-BBS12 Antibody 25ul