ORAI1,CRACM1
  • ORAI1,CRACM1

Anti-ORAI1 Antibody 25ul

Ref: AN-HPA061823-25ul
Anti-ORAI1

Información del producto

Polyclonal Antibody against Human ORAI1, Gene description: ORAI calcium release-activated calcium modulator 1, Alternative Gene Names: CRACM1, FLJ14466, TMEM142A, Validated applications: ICC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ORAI1
Gene Description ORAI calcium release-activated calcium modulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA
Immunogen VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRACM1, FLJ14466, TMEM142A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ORAI1 Antibody 25ul

Anti-ORAI1 Antibody 25ul