PSMB5,MB1,X
  • PSMB5,MB1,X

Anti-PSMB5 Antibody 25ul

Ref: AN-HPA061796-25ul
Anti-PSMB5

Información del producto

Polyclonal Antibody against Human PSMB5, Gene description: proteasome subunit beta 5, Alternative Gene Names: MB1, X, Validated applications: ICC, Uniprot ID: P28074, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PSMB5
Gene Description proteasome subunit beta 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Immunogen LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MB1, X
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28074
HTS Code 3002150000
Gene ID 5693
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PSMB5 Antibody 25ul

Anti-PSMB5 Antibody 25ul